Lineage for d7agkb1 (7agk B:1-298)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2512071Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2512072Protein automated matches [190117] (50 species)
    not a true protein
  7. 2512183Species Escherichia coli [TaxId:83333] [402932] (3 PDB entries)
  8. 2512191Domain d7agkb1: 7agk B:1-298 [403007]
    Other proteins in same PDB: d7agkb2, d7agkc2
    automated match to d4xdaa_
    complexed with rah

Details for d7agkb1

PDB Entry: 7agk (more details), 2.97 Å

PDB Description: crystal structure of e. coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp)
PDB Compounds: (B:) Sulfofructose kinase

SCOPe Domain Sequences for d7agkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7agkb1 c.72.1.0 (B:1-298) automated matches {Escherichia coli [TaxId: 83333]}
mirvacvgitvmdriyyveglptesgkyvarnytevgggpaataavaaarlgaqvdfigr
vgdddtgnsllaeleswgvntrytkrynqakssqsaimvdtkgeriiinypspdllpdae
wleeidfsqwdvvladvrwhdgakkaftlarqagvmtvldgditpqdiselvalsdhaaf
sepglarltgvkemasalkqaqtltnghvyvtqgsagcdwlenggrqhqpafkvdvvdtt
gagdvfhgalavalatsgdlaesvrfasgvaalkctrpggragipdcdqtrsflslfv

SCOPe Domain Coordinates for d7agkb1:

Click to download the PDB-style file with coordinates for d7agkb1.
(The format of our PDB-style files is described here.)

Timeline for d7agkb1: