Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Escherichia coli [TaxId:83333] [402932] (3 PDB entries) |
Domain d7agkb1: 7agk B:1-298 [403007] Other proteins in same PDB: d7agkb2, d7agkc2 automated match to d4xdaa_ complexed with rah |
PDB Entry: 7agk (more details), 2.97 Å
SCOPe Domain Sequences for d7agkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7agkb1 c.72.1.0 (B:1-298) automated matches {Escherichia coli [TaxId: 83333]} mirvacvgitvmdriyyveglptesgkyvarnytevgggpaataavaaarlgaqvdfigr vgdddtgnsllaeleswgvntrytkrynqakssqsaimvdtkgeriiinypspdllpdae wleeidfsqwdvvladvrwhdgakkaftlarqagvmtvldgditpqdiselvalsdhaaf sepglarltgvkemasalkqaqtltnghvyvtqgsagcdwlenggrqhqpafkvdvvdtt gagdvfhgalavalatsgdlaesvrfasgvaalkctrpggragipdcdqtrsflslfv
Timeline for d7agkb1:
View in 3D Domains from other chains: (mouse over for more information) d7agka_, d7agkc1, d7agkc2, d7agkd_ |