Lineage for d1sat_2 (1sat 4-246)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194638Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)
  6. 194639Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)
  7. 194644Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
  8. 194645Domain d1sat_2: 1sat 4-246 [40300]
    Other proteins in same PDB: d1sat_1

Details for d1sat_2

PDB Entry: 1sat (more details), 1.75 Å

PDB Description: crystal structure of the 50 kda metallo protease from s. marcescens

SCOP Domain Sequences for d1sat_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sat_2 d.92.1.6 (4-246) Metallo protease, catalytic (N-terminal) domain {Serratia marcescens}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegdptyadvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

SCOP Domain Coordinates for d1sat_2:

Click to download the PDB-style file with coordinates for d1sat_2.
(The format of our PDB-style files is described here.)

Timeline for d1sat_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sat_1