Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Pseudomonas aeruginosa [TaxId:287] [55510] (3 PDB entries) alkaline protease |
Domain d1akla2: 1akl A:1-246 [40299] Other proteins in same PDB: d1akla1 complexed with ca, zn |
PDB Entry: 1akl (more details), 2 Å
SCOPe Domain Sequences for d1akla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akla2 d.92.1.6 (A:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia aiqkly
Timeline for d1akla2: