Lineage for d1akl_2 (1akl 1-246)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194638Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)
  6. 194639Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)
  7. 194640Species Pseudomonas aeruginosa, alkaline protease [55510] (3 PDB entries)
  8. 194643Domain d1akl_2: 1akl 1-246 [40299]
    Other proteins in same PDB: d1akl_1

Details for d1akl_2

PDB Entry: 1akl (more details), 2 Å

PDB Description: alkaline protease from pseudomonas aeruginosa ifo3080

SCOP Domain Sequences for d1akl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akl_2 d.92.1.6 (1-246) Metallo protease, catalytic (N-terminal) domain {Pseudomonas aeruginosa, alkaline protease}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

SCOP Domain Coordinates for d1akl_2:

Click to download the PDB-style file with coordinates for d1akl_2.
(The format of our PDB-style files is described here.)

Timeline for d1akl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akl_1