![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) ![]() |
![]() | Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein) |
![]() | Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species) |
![]() | Species Pseudomonas aeruginosa, alkaline protease [55510] (2 PDB entries) |
![]() | Domain d1akl_2: 1akl 1-246 [40299] Other proteins in same PDB: d1akl_1 |
PDB Entry: 1akl (more details), 2 Å
SCOP Domain Sequences for d1akl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akl_2 d.92.1.6 (1-246) Metallo protease, catalytic (N-terminal) domain {Pseudomonas aeruginosa, alkaline protease} grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia aiqkly
Timeline for d1akl_2: