Lineage for d7bi1a_ (7bi1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333060Protein Ascorbate peroxidase [48123] (3 species)
  7. 2333066Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
    Uniprot Q43758
  8. 2333071Domain d7bi1a_: 7bi1 A: [402985]
    automated match to d1oaga_
    complexed with hem, k

Details for d7bi1a_

PDB Entry: 7bi1 (more details), 1.5 Å

PDB Description: xfel crystal structure of soybean ascorbate peroxidase compound ii
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d7bi1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bi1a_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d7bi1a_:

Click to download the PDB-style file with coordinates for d7bi1a_.
(The format of our PDB-style files is described here.)

Timeline for d7bi1a_: