Lineage for d1kapp2 (1kap P:1-246)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 331960Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 331961Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 331968Species Pseudomonas aeruginosa [TaxId:287] [55510] (3 PDB entries)
    alkaline protease
  8. 331969Domain d1kapp2: 1kap P:1-246 [40298]
    Other proteins in same PDB: d1kapp1
    complexed with ca, zn

Details for d1kapp2

PDB Entry: 1kap (more details), 1.64 Å

PDB Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif

SCOP Domain Sequences for d1kapp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

SCOP Domain Coordinates for d1kapp2:

Click to download the PDB-style file with coordinates for d1kapp2.
(The format of our PDB-style files is described here.)

Timeline for d1kapp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kapp1