Lineage for d1kapp2 (1kap P:1-246)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135758Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)
  6. 135759Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)
  7. 135760Species Pseudomonas aeruginosa, alkaline protease [55510] (3 PDB entries)
  8. 135761Domain d1kapp2: 1kap P:1-246 [40298]
    Other proteins in same PDB: d1kapp1

Details for d1kapp2

PDB Entry: 1kap (more details), 1.64 Å

PDB Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif

SCOP Domain Sequences for d1kapp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kapp2 d.92.1.6 (P:1-246) Metallo protease, catalytic (N-terminal) domain {Pseudomonas aeruginosa, alkaline protease}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

SCOP Domain Coordinates for d1kapp2:

Click to download the PDB-style file with coordinates for d1kapp2.
(The format of our PDB-style files is described here.)

Timeline for d1kapp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kapp1