Lineage for d1i1ip_ (1i1i P:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529230Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 2529271Protein Neurolysin (endopeptidase 24.16, thimet oligopeptidase) [55506] (2 species)
    M3 family member; the thermolysin-like catalytic domain consists of residues 352-674
  7. 2529275Species Norway rat (Rattus norvegicus) [TaxId:10116] [55507] (1 PDB entry)
  8. 2529276Domain d1i1ip_: 1i1i P: [40297]
    complexed with zn

Details for d1i1ip_

PDB Entry: 1i1i (more details), 2.3 Å

PDB Description: neurolysin (endopeptidase 24.16) crystal structure
PDB Compounds: (P:) Neurolysin

SCOPe Domain Sequences for d1i1ip_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mssytaagrnvlrwdlspeqiktrteqliaqtkqvydtvgtialkevtyenclqvladie
vtyivertmldfpqhvssdrevraasteadkklsrfdiemsmredvfqrivhlqetcdle
kikpearryleksikmgkrnglhlsehirneiksmkkrmselcidfnknlneddtslvfs
kaelgalpddfidslektdedkykvtlkyphyfpvmkkccvpetrrkmemafhtrckqen
tailqqllplraqvakllgynthadfvlelntakstsrvaaflddlsqklkplgeaeref
ilslkkkeceergfeydgkinawdlhyymtqteelkysvdqeslkeyfpievvtegllsi
yqellglsfeqvpdahvwnksvslytvkdkatgevlgqfyldlypregkynhaacfglqp
gcllpdgsrmmsvaalvvnfsqpvagrpsllrhdevrtyfhefghvmhqicaqtdfarfs
gtnvetdfvevpsqmlenwvwdvdslrklskhykdghpitdelleklvasrlvntglltl
rqivlskvdqslhtnatldaaseyakycteilgvaatpgtnmpatfghlaggydgqyygy
lwsevfsmdmfhscfkkegimnpevgmkyrnlilkpggsldgmdmlqnflqrepnqkafl
msrgl

SCOPe Domain Coordinates for d1i1ip_:

Click to download the PDB-style file with coordinates for d1i1ip_.
(The format of our PDB-style files is described here.)

Timeline for d1i1ip_: