Lineage for d7b18e_ (7b18 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356783Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 2356852Domain d7b18e_: 7b18 E: [402969]
    automated match to d5m2jd_
    complexed with nag

Details for d7b18e_

PDB Entry: 7b18 (more details), 2.62 Å

PDB Description: sars-cov-spike bound to two neutralising nanobodies
PDB Compounds: (E:) Nanobody against spike glycoprotein VHH V

SCOPe Domain Sequences for d7b18e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b18e_ b.1.1.1 (E:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvetggglvqpggslrlscaasgftfssyamgwarqvpgkglewvsyiysdgsteyq
dsvkgrftisrdnakstvylqmnslkpedtavyycategslggwgrdfgswgqgtqvtvs
s

SCOPe Domain Coordinates for d7b18e_:

Click to download the PDB-style file with coordinates for d7b18e_.
(The format of our PDB-style files is described here.)

Timeline for d7b18e_: