SCOPe 2.07: Domain d7bfka_: 7bfk A:

Lineage for d7bfka_ (7bfk A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Salmo salar [TaxId:8030] [402957] (2 PDB entries)

8. Domain d7bfka_: 7bfk A: [402958]
   automated match to d2vq9a_

Details for d7bfka_

PDB Entry: 7bfk, 1.89 Å

PDB Description: x-ray structure of ss-rnase-2

PDB Compounds: (A:) Angiogenin-1

SCOPe Domain Sequences for d7bfka_:

Sequence; same for both SEQRES and ATOM records:

>d7bfka_ d.5.1.0 (A:) automated matches {Salmo salar [TaxId: 8030]}
mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgdvd
igitd

Timeline for d7bfka_:

• d7bfka_ is new in SCOPe 2.07-stable
  
• d7bfka_ appears in the current release, SCOPe 2.08