Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (3 proteins) automatically mapped to Pfam PF07221 |
Protein automated matches [402934] (1 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [402935] (1 PDB entry) |
Domain d7ag4a_: 7ag4 A: [402937] Other proteins in same PDB: d7ag4b2, d7ag4c2, d7ag4d2, d7ag4e2, d7ag4f2 automated match to d2rgka_ complexed with rb8; mutant |
PDB Entry: 7ag4 (more details), 2.13 Å
SCOPe Domain Sequences for d7ag4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ag4a_ a.102.1.3 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]} mkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr ayggtpgawiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw wqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinak
Timeline for d7ag4a_: