Lineage for d7ag4a_ (7ag4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335287Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (3 proteins)
    automatically mapped to Pfam PF07221
  6. 2335313Protein automated matches [402934] (1 species)
    not a true protein
  7. 2335314Species Salmonella typhimurium [TaxId:99287] [402935] (1 PDB entry)
  8. 2335315Domain d7ag4a_: 7ag4 A: [402937]
    Other proteins in same PDB: d7ag4b2, d7ag4c2, d7ag4d2, d7ag4e2, d7ag4f2
    automated match to d2rgka_
    complexed with rb8; mutant

Details for d7ag4a_

PDB Entry: 7ag4 (more details), 2.13 Å

PDB Description: crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf)
PDB Compounds: (A:) Sulfoquinovose isomerase

SCOPe Domain Sequences for d7ag4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ag4a_ a.102.1.3 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
mkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
ayggtpgawiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
wqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldinak

SCOPe Domain Coordinates for d7ag4a_:

Click to download the PDB-style file with coordinates for d7ag4a_.
(The format of our PDB-style files is described here.)

Timeline for d7ag4a_: