Lineage for d1esp_2 (1esp 1-156)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34313Family d.92.1.2: Thermolysin-like [55490] (4 proteins)
  6. 34320Protein Neutral protease [55495] (1 species)
  7. 34321Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries)
  8. 34323Domain d1esp_2: 1esp 1-156 [40293]
    Other proteins in same PDB: d1esp_1

Details for d1esp_2

PDB Entry: 1esp (more details), 2.8 Å

PDB Description: neutral protease mutant e144s

SCOP Domain Sequences for d1esp_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esp_2 d.92.1.2 (1-156) Neutral protease {Bacillus cereus, strain dsm 3101}
vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
mvygdgdgvtftslsggidvighslthavtenssnl

SCOP Domain Coordinates for d1esp_2:

Click to download the PDB-style file with coordinates for d1esp_2.
(The format of our PDB-style files is described here.)

Timeline for d1esp_2:

  • d1esp_2 does not appear in SCOP 1.57

View in 3D
Domains from same chain:
(mouse over for more information)
d1esp_1