SCOPe 2.08: Domain d6ye5a1: 6ye5 A:2-116

Lineage for d6ye5a1 (6ye5 A:2-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families)
   possible distant homologue of the type I KH domain lacking the KH motif
   automatically mapped to Pfam PF02033

5. Family d.52.7.0: automated matches [254257] (1 protein)
   not a true family

6. Protein automated matches [254591] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [402872] (1 PDB entry)

8. Domain d6ye5a1: 6ye5 A:2-116 [402873]
   Other proteins in same PDB: d6ye5a2, d6ye5a3
   automated match to d1josa_

Details for d6ye5a1

PDB Entry: 6ye5

PDB Description: structure of ribosomal binding factor a rbfa of staphylococcus aureus bacterium by nmr

PDB Compounds: (A:) ribosome-binding factor a

SCOPe Domain Sequences for d6ye5a1:

Sequence; same for both SEQRES and ATOM records:

>d6ye5a1 d.52.7.0 (A:2-116) automated matches {Staphylococcus aureus [TaxId: 1280]}
ssmraervgeqmkkelmdiinnkvkdprvgfititdvvltndlsqakvfltvlgndkeve
ntfkaldkakgfikselgsrmrlrimpelmyeydqsieygnkiermiqdlhkqdr

Timeline for d6ye5a1:

• d6ye5a1 first appeared in SCOPe 2.07