Lineage for d6ye9a1 (6ye9 A:1-231)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726519Protein automated matches [190238] (11 species)
    not a true protein
  7. 2726535Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2726557Domain d6ye9a1: 6ye9 A:1-231 [402865]
    Other proteins in same PDB: d6ye9a2
    automated match to d2o98a_
    complexed with mg, oo8

Details for d6ye9a1

PDB Entry: 6ye9 (more details), 1.8 Å

PDB Description: small-molecule inhibitor of 14-3-3 protein-protein interactions
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d6ye9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ye9a1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d6ye9a1:

Click to download the PDB-style file with coordinates for d6ye9a1.
(The format of our PDB-style files is described here.)

Timeline for d6ye9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ye9a2