Lineage for d7d1th_ (7d1t h:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631824Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2631834Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)
  8. 2631835Domain d7d1th_: 7d1t h: [402775]
    Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1td_, d7d1te_, d7d1tf_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1tm_, d7d1to_, d7d1tu_, d7d1tv_, d7d1tx_, d7d1tz_
    automated match to d5h2fh_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1th_

PDB Entry: 7d1t (more details), 1.95 Å

PDB Description: cryo-em structure of psii at 1.95 angstrom resolution
PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7d1th_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1th_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d7d1th_:

Click to download the PDB-style file with coordinates for d7d1th_.
(The format of our PDB-style files is described here.)

Timeline for d7d1th_: