Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6xocb1: 6xoc B:1-107 [402743] Other proteins in same PDB: d6xocb2, d6xocl1, d6xocl2 automated match to d2ok0l1 complexed with edo, k, peg, scn, trs |
PDB Entry: 6xoc (more details), 2.45 Å
SCOPe Domain Sequences for d6xocb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xocb1 b.1.1.1 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvlmtqtplslpvslgdqasiscrssqnivhyngntylewylqkpgqspklliyqvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleik
Timeline for d6xocb1: