SCOPe 2.08: Domain d7d5bd1: 7d5b D:165-271

Lineage for d7d5bd1 (7d5b D:165-271)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d7d5bd1: 7d5b D:165-271 [402673]
   Other proteins in same PDB: d7d5ba_, d7d5bd2
   automated match to d5m2jd_
   complexed with 66f, cl, edo, na

Details for d7d5bd1

PDB Entry: 7d5b, 1.31 Å

PDB Description: bace2 xaperone complex with n-{3-[(5r)-3-amino-2,5-dimethyl-1,1-dioxo- 5,6-dihydro-2h-1lambda6,2,4-thiadiazin-5-yl]-4-fluorophenyl}-5- fluoropyridine-2-carboxamide

PDB Compounds: (D:) xaperone

SCOPe Domain Sequences for d7d5bd1:

Sequence; same for both SEQRES and ATOM records:

>d7d5bd1 b.1.1.1 (D:165-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss

Timeline for d7d5bd1:

• d7d5bd1 first appeared in SCOPe 2.07