Lineage for d5tmne2 (5tmn E:1-155)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.2: Thermolysin-like [55490] (4 proteins) 
Protein Thermolysin [55493] (1 species) Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (32 PDB entries) 
Domain d5tmne2: 5tmn E:1-155 [40266]
Other proteins in same PDB: d5tmne1
Details for d5tmne2
PDB Entry: 5tmn (more details), 1.6 Å
PDB Description: slow-and fast-binding inhibitors of thermolysin display different modes of binding. crystallographic analysis of extended phosphonamidate transition-state analogues
SCOP Domain Sequences for d5tmne2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmne2 d.92.1.2 (E:1-155) Thermolysin {Bacillus thermoproteolyticus}
itgtstvgvgrgvlgdqkninttystyyylqdntrgdgiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsem
vygdgdgqtfiplsggidvvahelthavtdytagl
SCOP Domain Coordinates for d5tmne2:
Click to download the PDB-style file with coordinates for d5tmne2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5tmne2:
- d5tmne2 does not appear in SCOP 1.57
View in 3D
