SCOPe 2.08: Domain d7nx7b2: 7nx7 B:107-213

Lineage for d7nx7b2 (7nx7 B:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7nx7b2: 7nx7 B:107-213 [402614]
   Other proteins in same PDB: d7nx7a_, d7nx7b1, d7nx7e_, d7nx7h_, d7nx7l1
   automated match to d1dn0a2
   complexed with cit, cl, gol, nag, so4; mutant

Details for d7nx7b2

PDB Entry: 7nx7, 2.3 Å

PDB Description: crystal structure of the k417n mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs

PDB Compounds: (B:) COVOX-222 Fab light chain

SCOPe Domain Sequences for d7nx7b2:

Sequence; same for both SEQRES and ATOM records:

>d7nx7b2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7nx7b2:

• d7nx7b2 first appeared in SCOPe 2.07