Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) |
Family d.92.1.1: Zinc protease [55487] (1 protein) |
Protein Zinc protease [55488] (1 species) |
Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries) |
Domain d1kuh__: 1kuh - [40258] |
PDB Entry: 1kuh (more details), 1.6 Å
SCOP Domain Sequences for d1kuh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuh__ d.92.1.1 (-) Zinc protease {Streptomyces caespitosus} tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq ersrvnalwang
Timeline for d1kuh__: