Lineage for d1dt9a3 (1dt9 A:5-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963570Fold d.91: N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55480] (1 superfamily)
    alpha-beta-alpha(2)-beta(3)-alpha; 3 layers a/b/a; antiparallel beta-sheet: 4123
  4. 2963571Superfamily d.91.1: N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55481] (2 families) (S)
    automatically mapped to Pfam PF03463
  5. 2963572Family d.91.1.1: N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55482] (1 protein)
  6. 2963573Protein N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55483] (1 species)
  7. 2963574Species Human (Homo sapiens) [TaxId:9606] [55484] (1 PDB entry)
  8. 2963575Domain d1dt9a3: 1dt9 A:5-142 [40257]
    Other proteins in same PDB: d1dt9a1, d1dt9a2

Details for d1dt9a3

PDB Entry: 1dt9 (more details), 2.7 Å

PDB Description: the crystal structure of human eukaryotic release factor erf1-mechanism of stop codon recognition and peptidyl-trna hydrolysis
PDB Compounds: (A:) protein (eukaryotic peptide chain release factor subunit 1)

SCOPe Domain Sequences for d1dt9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt9a3 d.91.1.1 (A:5-142) N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}
psaadrnveiwkikkliksleaargngtsmisliippkdqisrvakmladefgtasniks
rvnrlsvlgaitsvqqrlklynkvppnglvvycgtivteegkekkvnidfepfkpintsl
ylcdnkfhtealtallsd

SCOPe Domain Coordinates for d1dt9a3:

Click to download the PDB-style file with coordinates for d1dt9a3.
(The format of our PDB-style files is described here.)

Timeline for d1dt9a3: