| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
| Domain d7nqva2: 7nqv A:219-418 [402543] automated match to d3fe1a2 complexed with an2, cl, gol, jhj, pg4, po4 |
PDB Entry: 7nqv (more details), 2.37 Å
SCOPe Domain Sequences for d7nqva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nqva2 c.55.1.0 (A:219-418) automated matches {Plasmodium falciparum [TaxId: 36329]}
gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk
nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm
dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde
avaygaavqaailsgdqssa
Timeline for d7nqva2: