SCOPe 2.08: Domain d7nx8e_: 7nx8 E:

Lineage for d7nx8e_ (7nx8 E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)
   automatically mapped to Pfam PF09408

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
   part of PfamB PB000266

6. Protein Spike protein S1 [143589] (5 species)

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (118 PDB entries)

8. Domain d7nx8e_: 7nx8 E: [402529]
   Other proteins in same PDB: d7nx8a_, d7nx8b1, d7nx8b2, d7nx8h_, d7nx8l1, d7nx8l2
   automated match to d2dd8s1
   complexed with cit, cl, gol, nag, peg, so4; mutant

Details for d7nx8e_

PDB Entry: 7nx8, 1.95 Å

PDB Description: crystal structure of the k417t mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs

PDB Compounds: (E:) Spike protein S1

SCOPe Domain Sequences for d7nx8e_:

Sequence; same for both SEQRES and ATOM records:

>d7nx8e_ d.318.1.1 (E:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
nlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcft
nvyadsfvirgdevrqiapgqtgtiadynyklpddftgcviawnsnnldskvggnynyly
rlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvl
sfellhapatvcgk

Timeline for d7nx8e_:

• d7nx8e_ first appeared in SCOPe 2.07