Lineage for d7cohn_ (7coh N:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632350Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 2632351Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries)
  8. 2632353Domain d7cohn_: 7coh N: [402504]
    Other proteins in same PDB: d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
    automated match to d1v54a_
    complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohn_

PDB Entry: 7coh (more details), 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d7cohn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cohn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnl

SCOPe Domain Coordinates for d7cohn_:

Click to download the PDB-style file with coordinates for d7cohn_.
(The format of our PDB-style files is described here.)

Timeline for d7cohn_: