SCOPe 2.08: Domain d7lsfl1: 7lsf L:1-106

Lineage for d7lsfl1 (7lsf L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d7lsfl1: 7lsf L:1-106 [402399]
   Other proteins in same PDB: d7lsfe_, d7lsfl2
   automated match to d1dn0a1
   complexed with gol, na

Details for d7lsfl1

PDB Entry: 7lsf, 2.24 Å

PDB Description: crystal structure of the human neutralizing antibody fab fragment t025 bound to tbev ediii (western subtype)

PDB Compounds: (L:) T025 Fab Light Chain

SCOPe Domain Sequences for d7lsfl1:

Sequence; same for both SEQRES and ATOM records:

>d7lsfl1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspatlsvspgeratlscwasqsvssnlawyqqkpgqaprlliygastratgipa
rfsasgsgteftltisslqsedfavyycqqynnwpprfgqgtkvei

Timeline for d7lsfl1:

• d7lsfl1 first appeared in SCOPe 2.07