Lineage for d7lxia_ (7lxi A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2469469Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 2469505Protein automated matches [191052] (2 species)
    not a true protein
  7. 3099382Species Mycobacterium tuberculosis [TaxId:83332] [399444] (2 PDB entries)
  8. 3102331Domain d7lxia_: 7lxi A: [402393]
    automated match to d1kpga_
    complexed with cl, edo, no3, p6g, po4, sah

Details for d7lxia_

PDB Entry: 7lxi (more details), 1.95 Å

PDB Description: crystal structure of s-adenosylmethionine-dependent methyltransferase umaa from mycobacterium tuberculosis in complex with sah
PDB Compounds: (A:) S-adenosylmethionine-dependent methyltransferase UmaA

SCOPe Domain Sequences for d7lxia_:

Sequence, based on SEQRES records: (download)

>d7lxia_ c.66.1.18 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lrpfyeesqsiydvsdeffslfldptmaytcayferedmtleeaqnakfdlaldklhlep
gmtlldigcgwggglqraienydvnvigitlsrnqfeyskaklakiptersvqvrlqgwd
eftdkvdrivsigafeafkmeryaaffersydilpddgrmllhtiltytqkqmhemgvkv
tmsdvrfmkfigeeifpggqlpaqedifkfaqaadfsvekvqllqqhyartlniwaanle
ankdraialqseeiynkymhyltgcehffrkgisnvgqftltk

Sequence, based on observed residues (ATOM records): (download)

>d7lxia_ c.66.1.18 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lrpfyeesqsiydvsdeffslfldptmaytcayferedmtleeaqnakfdlaldklhlep
gmtlldigcgwggglqraienydvnvigitlsrnqfeyskaklakiptersvqvrlqgwd
eftdkvdrivsigafeafkmeryaaffersydilpddgrmllhtiltytqkqmhemgvkv
tmsdvrfmkfigeeiqlpaqedifkfaqaadfsvekvqllqqhyartlniwaanleankd
raialqseeiynkymhyltgcehffrkgisnvgqftltk

SCOPe Domain Coordinates for d7lxia_:

Click to download the PDB-style file with coordinates for d7lxia_.
(The format of our PDB-style files is described here.)

Timeline for d7lxia_:

  • d7lxia_ is new in SCOPe 2.07-stable