SCOPe 2.08: Domain d7lvwj1: 7lvw J:1-111

Lineage for d7lvwj1 (7lvw J:1-111)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
Domain d7lvwj1: 7lvw J:1-111 [402349]
Other proteins in same PDB: d7lvwg2, d7lvwh2, d7lvwi2, d7lvwj2, d7lvwk2, d7lvwl2
automated match to d4w81a_
complexed with cl, nag

Details for d7lvwj1

PDB Entry: 7lvw (more details), 2.1 Å

PDB Description: structure of rsv f in complex with vhh cl184

PDB Compounds: (J:) F-VHH-Cl184

SCOPe Domain Sequences for d7lvwj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lvwj1 b.1.1.1 (J:1-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgqtfsgyvtgwfrqapgkerefvaliawsggrlyy
adsvqgrftisrdnaettvylqmnslkpedtavyycaakrggavtaaewydywgqgtqvt
v

SCOPe Domain Coordinates for d7lvwj1:

Click to download the PDB-style file with coordinates for d7lvwj1.
(The format of our PDB-style files is described here.)

Timeline for d7lvwj1: