Lineage for d7ljuc1 (7lju C:3-183)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689683Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 2689684Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 2689685Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries)
  8. 2689692Domain d7ljuc1: 7lju C:3-183 [402312]
    Other proteins in same PDB: d7ljua2, d7ljua3, d7ljua4, d7ljua5, d7ljub2, d7ljub3, d7ljub4, d7ljub5, d7ljuc2, d7ljuc3, d7ljuc4, d7ljuc5, d7ljud2, d7ljud3, d7ljud4, d7ljud5
    automated match to d1gtea1
    complexed with fad, fnr, nap, sf4, y3g

Details for d7ljuc1

PDB Entry: 7lju (more details), 1.87 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) crosslinked with 5- ethynyluracil (5eu)
PDB Compounds: (C:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljuc1 a.1.2.2 (C:3-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
pvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfddi
khttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnpl
gltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqekm
p

SCOPe Domain Coordinates for d7ljuc1:

Click to download the PDB-style file with coordinates for d7ljuc1.
(The format of our PDB-style files is described here.)

Timeline for d7ljuc1: