Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) automatically mapped to Pfam PF02507 |
Family f.23.16.0: automated matches [276195] (1 protein) not a true family |
Protein automated matches [276199] (5 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276202] (9 PDB entries) |
Domain d7dkzf_: 7dkz F: [402307] Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzj_, d7dkzl_ automated match to d5l8rf_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 7dkz (more details), 2.39 Å
SCOPe Domain Sequences for d7dkzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dkzf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii idvplatrlvfrgfswpiaayrellngelvak
Timeline for d7dkzf_: