Lineage for d7ljsb1 (7ljs B:3-183)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2303053Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2303145Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 2303146Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 2303147Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries)
  8. 2303177Domain d7ljsb1: 7ljs B:3-183 [402294]
    Other proteins in same PDB: d7ljsa2, d7ljsa3, d7ljsa4, d7ljsa5, d7ljsb2, d7ljsb3, d7ljsb4, d7ljsb5, d7ljsc2, d7ljsc3, d7ljsc4, d7ljsc5, d7ljsd2, d7ljsd3, d7ljsd4, d7ljsd5
    automated match to d1gteb1
    complexed with fad, fmn, sf4, y3g

Details for d7ljsb1

PDB Entry: 7ljs (more details), 2 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) complexed with 5- ethynyluracil (5eu) - open form
PDB Compounds: (B:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljsb1 a.1.2.2 (B:3-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
pvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfddi
khttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnpl
gltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqekm
p

SCOPe Domain Coordinates for d7ljsb1:

Click to download the PDB-style file with coordinates for d7ljsb1.
(The format of our PDB-style files is described here.)

Timeline for d7ljsb1: