SCOPe 2.06: Domain d1fiqb1: 1fiq B:415-528

Lineage for d1fiqb1 (1fiq B:415-528)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)

6. Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries)
   Uniprot P80457

8. Domain d1fiqb1: 1fiq B:415-528 [40229]
   Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb2, d1fiqc1, d1fiqc2
   complexed with fad, fes, gol, mos, mte, sal

Details for d1fiqb1

PDB Entry: 1fiq, 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk

PDB Compounds: (B:) xanthine oxidase

SCOPe Domain Sequences for d1fiqb1:

Sequence; same for both SEQRES and ATOM records:

>d1fiqb1 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d1fiqb1:

• d1fiqb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fiqb1 appears in SCOPe 2.05
  
• d1fiqb1 appears in SCOPe 2.07
  
• d1fiqb1 appears in the current release, SCOPe 2.08