Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries) Uniprot P80457 |
Domain d1fiqb1: 1fiq B:415-528 [40229] Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb2, d1fiqc1, d1fiqc2 complexed with fad, fes, gol, mos, mte, sal |
PDB Entry: 1fiq (more details), 2.5 Å
SCOPe Domain Sequences for d1fiqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fiqb1 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d1fiqb1:
View in 3D Domains from other chains: (mouse over for more information) d1fiqa1, d1fiqa2, d1fiqc1, d1fiqc2 |