Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries) Uniprot P80457 |
Domain d1fo4b4: 1fo4 B:415-528 [40228] Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b5, d1fo4b6 complexed with ca, fad, fes, gol, mos, mte, sal |
PDB Entry: 1fo4 (more details), 2.1 Å
SCOPe Domain Sequences for d1fo4b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4b4 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d1fo4b4: