Lineage for d1ffuc1 (1ffu C:178-287)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34232Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 34233Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (2 proteins)
  6. 34234Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 34235Species Hydrogenophaga pseudoflava [TaxId:47421] [55451] (2 PDB entries)
  8. 34238Domain d1ffuc1: 1ffu C:178-287 [40225]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffub2, d1ffuc2, d1ffud1, d1ffud2, d1ffue1, d1ffue2, d1ffuf2

Details for d1ffuc1

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffuc1 d.87.2.1 (C:178-287) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Hydrogenophaga pseudoflava}
gtgwayeklkrktgdwatagcavvmrksggtvshirialtnvaptalraeaaeaallgka
ftkeavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca

SCOP Domain Coordinates for d1ffuc1:

Click to download the PDB-style file with coordinates for d1ffuc1.
(The format of our PDB-style files is described here.)

Timeline for d1ffuc1: