![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
![]() | Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries) |
![]() | Domain d7ljsa1: 7ljs A:2-183 [402243] Other proteins in same PDB: d7ljsa2, d7ljsa3, d7ljsa4, d7ljsa5, d7ljsb2, d7ljsb3, d7ljsb4, d7ljsb5, d7ljsc2, d7ljsc3, d7ljsc4, d7ljsc5, d7ljsd2, d7ljsd3, d7ljsd4, d7ljsd5 automated match to d1gtea1 complexed with fad, fmn, sf4, y3g |
PDB Entry: 7ljs (more details), 2 Å
SCOPe Domain Sequences for d7ljsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljsa1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek mp
Timeline for d7ljsa1:
![]() Domains from same chain: (mouse over for more information) d7ljsa2, d7ljsa3, d7ljsa4, d7ljsa5 |