Lineage for d1ffvf1 (1ffv F:178-287)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 82098Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 82099Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (2 proteins)
  6. 82100Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 82101Species Hydrogenophaga pseudoflava [TaxId:47421] [55451] (2 PDB entries)
  8. 82103Domain d1ffvf1: 1ffv F:178-287 [40224]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb1, d1ffvb2, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve1, d1ffve2, d1ffvf2

Details for d1ffvf1

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvf1 d.87.2.1 (F:178-287) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Hydrogenophaga pseudoflava}
gtgwayeklkrktgdwatagcavvmrksgntvshirialtnvaptalraeaaeaallgka
ftkeavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca

SCOP Domain Coordinates for d1ffvf1:

Click to download the PDB-style file with coordinates for d1ffvf1.
(The format of our PDB-style files is described here.)

Timeline for d1ffvf1: