Lineage for d1qj2i1 (1qj2 I:178-285)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135569Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 135570Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (3 proteins)
  6. 135571Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 135577Species Pseudomonas carboxydovorans [55450] (1 PDB entry)
  8. 135579Domain d1qj2i1: 1qj2 I:178-285 [40222]
    Other proteins in same PDB: d1qj2a1, d1qj2a2, d1qj2b1, d1qj2b2, d1qj2c2, d1qj2g1, d1qj2g2, d1qj2h1, d1qj2h2, d1qj2i2

Details for d1qj2i1

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2i1 d.87.2.1 (I:178-285) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Pseudomonas carboxydovorans}
ghgyayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakar

SCOP Domain Coordinates for d1qj2i1:

Click to download the PDB-style file with coordinates for d1qj2i1.
(The format of our PDB-style files is described here.)

Timeline for d1qj2i1: