Lineage for d7ljtb4 (7ljt B:533-844)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436768Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 2436769Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries)
  8. 2436795Domain d7ljtb4: 7ljt B:533-844 [402207]
    Other proteins in same PDB: d7ljta1, d7ljta2, d7ljta3, d7ljta5, d7ljtb1, d7ljtb2, d7ljtb3, d7ljtb5, d7ljtc1, d7ljtc2, d7ljtc3, d7ljtc5, d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd5
    automated match to d1gteb2
    complexed with fad, fmn, nap, sf4, y3g

Details for d7ljtb4

PDB Entry: 7ljt (more details), 1.98 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) soaked with 5- ethynyluracil (5eu), nadph - 20 minutes
PDB Compounds: (B:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljtb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljtb4 c.1.4.1 (B:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOPe Domain Coordinates for d7ljtb4:

Click to download the PDB-style file with coordinates for d7ljtb4.
(The format of our PDB-style files is described here.)

Timeline for d7ljtb4: