Lineage for d7daeb1 (7dae B:1-243)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863851Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)
  8. 2863855Domain d7daeb1: 7dae B:1-243 [402146]
    Other proteins in same PDB: d7daea2, d7daeb2, d7daec2, d7daed2, d7daee_, d7daef1, d7daef2, d7daef3
    automated match to d4drxb1
    complexed with acp, ca, cl, epb, gdp, gtp, mes, mg

Details for d7daeb1

PDB Entry: 7dae (more details), 2.39 Å

PDB Description: epb in complex with tubulin
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d7daeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7daeb1 c.32.1.1 (B:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d7daeb1:

Click to download the PDB-style file with coordinates for d7daeb1.
(The format of our PDB-style files is described here.)

Timeline for d7daeb1: