SCOPe 2.08: Domain d7jlnb2: 7jln B:108-212

Lineage for d7jlnb2 (7jln B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7jlnb2: 7jln B:108-212 [402124]
   Other proteins in same PDB: d7jlnb1, d7jlnl1, d7jlnl2
   automated match to d4rgne2
   complexed with na, nh4

Details for d7jlnb2

PDB Entry: 7jln, 2.57 Å

PDB Description: crystal structure of glvrc01 fab in complex with anti-idiotype iv9 fab

PDB Compounds: (B:) iv9 Light Chain

SCOPe Domain Sequences for d7jlnb2:

Sequence; same for both SEQRES and ATOM records:

>d7jlnb2 b.1.1.0 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d7jlnb2:

• d7jlnb2 first appeared in SCOPe 2.07