Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries) |
Domain d7jwea2: 7jwe A:545-725 [402118] Other proteins in same PDB: d7jwea1, d7jwea3 automated match to d1e8ya1 complexed with vl1 |
PDB Entry: 7jwe (more details), 2.55 Å
SCOPe Domain Sequences for d7jwea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jwea2 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc g
Timeline for d7jwea2: