Lineage for d7kjzb1 (7kjz B:164-283)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803874Domain d7kjzb1: 7kjz B:164-283 [402100]
    Other proteins in same PDB: d7kjza2, d7kjzb2
    automated match to d1u2ba1
    complexed with 4ip, edo

Details for d7kjzb1

PDB Entry: 7kjz (more details), 2.43 Å

PDB Description: crystal structure of plekha7 ph domain biding inositol-tetraphosphate
PDB Compounds: (B:) Pleckstrin homology domain-containing family A member 7

SCOPe Domain Sequences for d7kjzb1:

Sequence, based on SEQRES records: (download)

>d7kjzb1 b.55.1.0 (B:164-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvvrgwlhkqkssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped
risrkysfkavhtgmraliynsstagsqaeqsgmrtyyfsadtqedmnawvramnqaaqv

Sequence, based on observed residues (ATOM records): (download)

>d7kjzb1 b.55.1.0 (B:164-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvvrgwlhkqkssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped
risrkysfkavhtrtyyfsadtqedmnawvramnqaaqv

SCOPe Domain Coordinates for d7kjzb1:

Click to download the PDB-style file with coordinates for d7kjzb1.
(The format of our PDB-style files is described here.)

Timeline for d7kjzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kjzb2