Lineage for d7d1tv_ (7d1t v:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304309Protein Cytochrome c550 [100991] (3 species)
  7. 2304315Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)
  8. 2304318Domain d7d1tv_: 7d1t v: [402078]
    Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1td_, d7d1te_, d7d1tf_, d7d1th_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1tm_, d7d1to_, d7d1tu_, d7d1tx_, d7d1tz_
    automated match to d3a0hv_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1tv_

PDB Entry: 7d1t (more details), 1.95 Å

PDB Description: cryo-em structure of psii at 1.95 angstrom resolution
PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d7d1tv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1tv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d7d1tv_:

Click to download the PDB-style file with coordinates for d7d1tv_.
(The format of our PDB-style files is described here.)

Timeline for d7d1tv_: