Lineage for d7dade_ (7dad E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733927Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries)
  8. 2733933Domain d7dade_: 7dad E: [402074]
    Other proteins in same PDB: d7dada1, d7dada2, d7dadb1, d7dadb2, d7dadc1, d7dadc2, d7dadd1, d7dadd2, d7dadf1, d7dadf2, d7dadf3
    automated match to d4i55e_
    complexed with acp, ca, cl, epd, gdp, gtp, mes, mg

Details for d7dade_

PDB Entry: 7dad (more details), 2.85 Å

PDB Description: epd in complex with tubulin
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d7dade_:

Sequence, based on SEQRES records: (download)

>d7dade_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d7dade_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d7dade_:

Click to download the PDB-style file with coordinates for d7dade_.
(The format of our PDB-style files is described here.)

Timeline for d7dade_: