Lineage for d7eamd1 (7eam D:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759488Domain d7eamd1: 7eam D:1-108 [402013]
    Other proteins in same PDB: d7eama_, d7eamb_, d7eamc_, d7eamd2, d7eamh_, d7eaml2
    automated match to d3ojda1
    complexed with nag

Details for d7eamd1

PDB Entry: 7eam (more details), 1.4 Å

PDB Description: immune complex of sars-cov-2 rbd and cross-neutralizing antibody 7d6
PDB Compounds: (D:) the light chain of Fab fragment of antibody 7D6

SCOPe Domain Sequences for d7eamd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7eamd1 b.1.1.0 (D:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstppwtfgggtklevk

SCOPe Domain Coordinates for d7eamd1:

Click to download the PDB-style file with coordinates for d7eamd1.
(The format of our PDB-style files is described here.)

Timeline for d7eamd1: