![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (14 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries) |
![]() | Domain d7d1td_: 7d1t D: [401947] Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1te_, d7d1tf_, d7d1th_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1tm_, d7d1to_, d7d1tu_, d7d1tv_, d7d1tx_, d7d1tz_ automated match to d5zznd_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7d1t (more details), 1.95 Å
SCOPe Domain Sequences for d7d1td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d1td_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef etfytknlllnegirawmapqdqpxenfvfpeevlprgnal
Timeline for d7d1td_: