SCOPe 2.07: Domain d7d1tf_: 7d1t F:

Lineage for d7d1tf_ (7d1t F:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (15 PDB entries)

8. Domain d7d1tf_: 7d1t F: [401945]
   Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1td_, d7d1te_, d7d1th_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1tm_, d7d1to_, d7d1tu_, d7d1tv_, d7d1tx_, d7d1tz_
   automated match to d2axtf1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1tf_

PDB Entry: 7d1t, 1.95 Å

PDB Description: cryo-em structure of psii at 1.95 angstrom resolution

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d7d1tf_:

Sequence; same for both SEQRES and ATOM records:

>d7d1tf_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d7d1tf_:

• d7d1tf_ is new in SCOPe 2.07-stable
  
• d7d1tf_ appears in the current release, SCOPe 2.08