Lineage for d7cohq_ (7coh Q:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024793Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 3024794Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 3024795Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3024796Species Cow (Bos taurus) [TaxId:9913] [81403] (32 PDB entries)
  8. 3024798Domain d7cohq_: 7coh Q: [401940]
    Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
    automated match to d1v54d_
    complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohq_

PDB Entry: 7coh (more details), 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d7cohq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cohq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
dyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlkfkesfa
emnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrmldmkva
piqgfsakwdydknewk

SCOPe Domain Coordinates for d7cohq_:

Click to download the PDB-style file with coordinates for d7cohq_.
(The format of our PDB-style files is described here.)

Timeline for d7cohq_: