Lineage for d7d1tm_ (7d1t M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631960Protein automated matches [196649] (5 species)
    not a true protein
  7. 2631969Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (6 PDB entries)
  8. 2631970Domain d7d1tm_: 7d1t M: [401937]
    Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1td_, d7d1te_, d7d1tf_, d7d1th_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1to_, d7d1tu_, d7d1tv_, d7d1tx_, d7d1tz_
    automated match to d2axtm1
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1tm_

PDB Entry: 7d1t (more details), 1.95 Å

PDB Description: cryo-em structure of psii at 1.95 angstrom resolution
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7d1tm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1tm_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqq

SCOPe Domain Coordinates for d7d1tm_:

Click to download the PDB-style file with coordinates for d7d1tm_.
(The format of our PDB-style files is described here.)

Timeline for d7d1tm_: