![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
![]() | Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
![]() | Protein automated matches [196649] (5 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (6 PDB entries) |
![]() | Domain d7d1tm_: 7d1t M: [401937] Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1td_, d7d1te_, d7d1tf_, d7d1th_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1to_, d7d1tu_, d7d1tv_, d7d1tx_, d7d1tz_ automated match to d2axtm1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7d1t (more details), 1.95 Å
SCOPe Domain Sequences for d7d1tm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d1tm_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mevnqlgliatalfvlvpsvfliilyvqtesqq
Timeline for d7d1tm_: