Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) automatically mapped to Pfam PF02284 |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries) |
Domain d7cohr_: 7coh R: [401913] Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_ automated match to d1v54e_ complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn |
PDB Entry: 7coh (more details), 1.3 Å
SCOPe Domain Sequences for d7cohr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cohr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} tdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasavr ilevvkdkagphkeiypyviqelrptlnelgistpeelgldk
Timeline for d7cohr_:
View in 3D Domains from other chains: (mouse over for more information) d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_ |